Mouse Anti-Zebrafish hpd Antibody (CBMOAB-79910FYA)


Cat: CBMOAB-79910FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO79910FYA
SpecificityThis antibody binds to Zebrafish hpd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish hpd Antibody is a mouse antibody against hpd. It can be used for hpd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names4-hydroxyphenylpyruvate dioxygenase; EC 1.13.11.27; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; hp
UniProt IDQ6TGZ5
Protein RefseqThe length of the protein is 397 amino acids long.
The sequence is show below: MTSYTDKGEKPERGKFLNFHHIKFWVGNAKQAAVFYCDKFGFEPLAYKGLETGSREVVSHAVRQDKIIFVFESALNPGNEEMGEHMIKHGDGVKDVAFLVEDCDFLVKKAKERGAAVLKEPWVEQDAGGKVKYAIVQTYGDTTHTFVEYLGPYKGLFLPGYKEPLFRDPLLPKLPSGHLSFIDHIVGNQPDDEMVPVSDWYQKCLLFHRFWSIDDKQIHTEYSALRSIVVTNYEETIKMPINEPAMGKKKSQIQEYIDYNGGPGVQHIALNTSNIIQAIVNLRARGLEFLSAPDNYYESLREKLKTAKIKVKEDLKTLQELKILVDFDDKGYLLQIFTKPVQDRPTLFLEVIQRNNHFGFGAGNFKSLFEAIEKDQDARGNLTVLTAQNQSVSKAFQ.
See other products for " HPD "
MO-AB-08453WMouse Anti-Cat HPD Antibody (MO-AB-08453W)
MO-AB-34899WMouse Anti-Ferret HPD Antibody (MO-AB-34899W)
MO-AB-04351HMouse Anti-Frog hpd Antibody (MO-AB-04351H)
MO-AB-00239WMouse Anti-Barrel medic HPD Antibody (MO-AB-00239W)
MO-AB-25821WMouse Anti-Chimpanzee HPD Antibody (MO-AB-25821W)
MO-AB-13779RMouse Anti-Cattle HPD Antibody (MO-AB-13779R)
MO-AB-02007WMouse Anti-Rhesus HPD Antibody (MO-AB-02007W)
MO-AB-26371RMouse Anti-Pig HPD Antibody (MO-AB-26371R)
MO-AB-15670YMouse Anti-Sheep HPD Antibody (MO-AB-15670Y)
CBMOAB-34684FYCMouse Anti-Arabidopsis HPD Antibody (CBMOAB-34684FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry