AibGenesis™ Mouse Anti-kcne4 Antibody (CBMOAB-81608FYA)


Cat: CBMOAB-81608FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81608FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO81608FYA 100 µg
MO-AB-08576Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08576Y 100 µg
MO-AB-14451R Monoclonal Cattle (Bos taurus) WB, ELISA MO14451R 100 µg
MO-AB-19901W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19901W 100 µg
MO-AB-26604H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26604C 100 µg
MO-AB-45236W Monoclonal Horse (Equus caballus) WB, ELISA MO45236W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO81608FYA
SpecificityThis antibody binds to Zebrafish kcne4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish kcne4 Antibody is a mouse antibody against kcne4. It can be used for kcne4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameskcne4; Potassium Voltage-Gated Channel Subfamily E Regulatory Subunit 4
UniProt IDQ1LVA7
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MDLARNATALSSPQNSRIPLSGGSDNNAYLYIVIVVSFYGVFLIGIMLGYLRTKRREKRRSNAFTRLLHEEEQREWGARQKKHSFSLPAFPALRSTPVPFMLSSGRAPLACALCSVEQSSVSSLSSGADVRFAIEEESDSGGHEETPKTGSGSENNSAGSSVENRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry