AibGenesis™ Mouse Anti-lamtor1 Antibody (CBMOAB-82407FYA)


Cat: CBMOAB-82407FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82407FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO82407FYA 100 µg
MO-AB-14801R Monoclonal Cattle (Bos taurus) WB, ELISA MO14801R 100 µg
MO-AB-17468W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17468W 100 µg
MO-AB-26732H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26732C 100 µg
MO-AB-58042W Monoclonal Marmoset WB, ELISA MO58042W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO82407FYA
SpecificityThis antibody binds to Zebrafish lamtor1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lamtor1 Antibody is a mouse antibody against lamtor1. It can be used for lamtor1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameslamtor1
UniProt IDE7FBZ6
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MGCCFSSDSETTDPDGDEVKPLIPDPNQERKPTNGSERNADNLPSNRTDEQALLTVILQRTALNIIDVSAVDSQGMEQHEYMDRARQYRWVTALKVLSRTLSQKKPVPLPSLTSQPHQVLAADLVPHADVQQVSKIAAYAYSAISQIKVDAKEELVVQFAIP.
For Research Use Only | Not For Clinical Use.
Online Inquiry