Mouse Anti-limd2 Antibody (CBMOAB-82751FYA)


Cat: CBMOAB-82751FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82751FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO82751FYA 100 µg
MO-AB-04860H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04860C 100 µg
MO-AB-14945R Monoclonal Cattle (Bos taurus) WB, ELISA MO14945R 100 µg
MO-AB-17227W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17227W 100 µg
MO-AB-26801H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26801C 100 µg
MO-AB-58204W Monoclonal Marmoset WB, ELISA MO58204W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO82751FYA
SpecificityThis antibody binds to Zebrafish limd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish limd2 Antibody is a mouse antibody against limd2. It can be used for limd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameslimd2
UniProt IDF1Q860
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: FICCGIHEAVPETDNRNTSDEKPVQRSKSFSFKTQKETCASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAALQGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWASKDAESIGKTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry