AibGenesis™ Mouse Anti-llph Antibody (CBMOAB-82840FYA)


Cat: CBMOAB-82840FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82840FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO82840FYA 100 µg
MO-AB-12502W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12502W 100 µg
MO-AB-26819H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26819C 100 µg
MO-AB-58242W Monoclonal Marmoset WB, ELISA MO58242W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO82840FYA
SpecificityThis antibody binds to Zebrafish llph.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates dendritic and spine growth and synaptic transmission. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish llph Antibody is a mouse antibody against llph. It can be used for llph detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein LLP homolog; Protein LAPS18-like; llph; NP_001032184.
UniProt IDQ3B748
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MAKSLRSKWRRKMRAEKRKKVAPKELARLKSALGQGEKGEISMKDVAEIATVVPPEKVKQKPADVDMQEEEADGGKMDLDTKRNKKTMLDEHGRYPVWMNQRQAKKLKAKRVGKNGKPKPKKRLAW.
For Research Use Only | Not For Clinical Use.
Online Inquiry