AibGenesis™ Mouse Anti-lrtomt Antibody (CBMOAB-85550FYA)


Cat: CBMOAB-85550FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85550FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO85550FYA 100 µg
MO-AB-04920H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04920C 100 µg
MO-AB-20899W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20899W 100 µg
MO-AB-58421W Monoclonal Marmoset WB, ELISA MO58421W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO85550FYA
SpecificityThis antibody binds to Zebrafish lrtomt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lrtomt Antibody is a mouse antibody against lrtomt. It can be used for lrtomt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameslrtomt
UniProt IDF1QQN4
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MFGSSVDFSFKEINTISDVLSDVPNSSAHPPKRDSEKKFISMSFRLNNNSIKDLTGLMDTLSALFSEPTRLAWLDLSFNEIKHIDSVLTQLKELRLLYLHGNNIQELSEVDKLAVLPSLHTITLHGNPIVSERDYRAHLIATLPHVKMIDFSAVTKQERELTSVWQKSRNTHKSTGYSKSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry