AibGenesis™ Mouse Anti-mpzl3 Antibody (CBMOAB-87322FYA)


Cat: CBMOAB-87322FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87322FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO87322FYA 100 µg
MO-AB-15958R Monoclonal Cattle (Bos taurus) WB, ELISA MO15958R 100 µg
MO-AB-27172H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27172C 100 µg
MO-AB-59291W Monoclonal Marmoset WB, ELISA MO59291W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO87322FYA
SpecificityThis antibody binds to Zebrafish mpzl3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mpzl3 Antibody is a mouse antibody against mpzl3. It can be used for mpzl3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:85923; mpzl
UniProt IDA4JYI5
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MMDVNRSAFKGLLWCVFFTSGLCMSVWSPAEVSVVSGSAVSLSCSFSSSSRVTSLMSVDWKFKPQSGGPAKLFFHFSSVAYPVEDERFRGRVKWTGSPSGGDASIQLLNATQNDNGTFSCSVRNPPDIQGNTAQTVLTVTPKRVSLTLTDVGVLLVCVVGPSAVVTLLLLSRICCCSEGPPALQHHSPIEVIAGEEYFYTQTQHKHSACCCYFKDSEYDEDEYMADKLHEHTITESQC.
For Research Use Only | Not For Clinical Use.
Online Inquiry