AibGenesis™ Mouse Anti-mrpl57 Antibody (CBMOAB-87424FYA)


Cat: CBMOAB-87424FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87424FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO87424FYA 100 µg
MO-AB-16035R Monoclonal Cattle (Bos taurus) WB, ELISA MO16035R 100 µg
MO-AB-17179W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17179W 100 µg
MO-AB-27222H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27222C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO87424FYA
SpecificityThis antibody binds to Zebrafish mrpl57.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein which belongs to an undetermined ribosomal subunit and which seems to be specific to animal mitoribosomes. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 3p, 5q, 8q, 14q, and Y. (From NCBI)
Product OverviewMouse Anti-Zebrafish mrpl57 Antibody is a mouse antibody against mrpl57. It can be used for mrpl57 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein 63, mitochondrial; mrpl57; mrp6
UniProt IDE9QEH3
Protein RefseqThe length of the protein is 108 amino acids long.
The sequence is show below: MLAVDLKTKLSLLRKGIPGKQWIGKYRRPRPVTWQIKRNVIKRLEQEAENEYWISRPFMTLEQERGHAAQRREWMWQQIKAERQAKFPEHKYIADQLNHLRVTKTWPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry