AibGenesis™ Mouse Anti-msgn1 Antibody (CBMOAB-87520FYA)


Cat: CBMOAB-87520FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87520FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO87520FYA 100 µg
MO-AB-05335H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05335C 100 µg
MO-AB-27263H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27263C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO87520FYA
SpecificityThis antibody binds to Zebrafish msgn1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish msgn1 Antibody is a mouse antibody against msgn1. It can be used for msgn1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMesogenin-1; MesP-related bHLH factor; Paraxial mesoderm-specific expression and regulatory capacities; pMesogenin1; pMsgn1; msgn1; mesp
UniProt IDQ90ZL1
Protein RefseqThe length of the protein is 131 amino acids long.
The sequence is show below: MAQIDVDVFTAKVLSHWDWSREDRSFGDSASSPESESFDSACSSPDARSSPTAGCEHAEQQKPKVKMSMRRRMKASEREKLRMRSLAEALHQLRDYLPPGYSRRGQPLTKIQTLKYTIQYIKELSGILEQQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry