AibGenesis™ Mouse Anti-mt-co2 Antibody (CBMOAB-87632FYA)


Cat: CBMOAB-87632FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87632FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO87632FYA 100 µg
MO-AB-08146W Monoclonal Cat (Felis catus) WB, ELISA MO08146W 100 µg
MO-AB-08881Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08881Y 100 µg
MO-AB-27285H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27285C 100 µg
MO-AB-34269W Monoclonal Donkey (Equus asinus) WB, ELISA MO34269W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO87632FYA
SpecificityThis antibody binds to Zebrafish mt-co2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mt-co2 Antibody is a mouse antibody against mt-co2. It can be used for mt-co2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 2; EC 1.9.3.1; Cytochrome c oxidase polypeptide II; mt-co2; coii cox2 coxii mtco
UniProt IDQ9MIY7
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MAHPAQLGFQDAASPVMEELLCFHDHALMIVFLISTLVLYIIIAMVSTKLTNKFILDSQEIEIVWTVLPAIILILIALPSLRILYLMDEINDPHVTIKAVGHQWYWSYEYTDYENLEFDSYMVPTQDLTPGGFRLLETDHRMVVPKESPIRILVSAEDVLHSWAVPSLGIKMDAVPGRLNQTAFIVSRPGVFYGQCSEICGANHSFMPIVVEAVPLEFFENWSSAMLEDA.
For Research Use Only | Not For Clinical Use.
Online Inquiry