AibGenesis™ Mouse Anti-mvb12a Antibody (CBMOAB-87837FYA)


Cat: CBMOAB-87837FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87837FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO87837FYA 100 µg
MO-AB-15206W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15206W 100 µg
MO-AB-16243R Monoclonal Cattle (Bos taurus) WB, ELISA MO16243R 100 µg
MO-AB-59562W Monoclonal Marmoset WB, ELISA MO59562W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO87837FYA
SpecificityThis antibody binds to Zebrafish mvb12a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mvb12a Antibody is a mouse antibody against mvb12a. It can be used for mvb12a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultivesicular body subunit 12A; ESCRT-I complex subunit MVB12A; Protein FAM125A; mvb12a; fam125
UniProt IDQ7SXX7
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MSVCDSSIRPVSAMAWASNTSTCPGHFTLISQTEDGASANFSRGFVRSGYFLCYSKDLSGGMVVADVQVITDKGTILHGYCYIPEYLEQKASVAKKKRVCVRLVPVGSVTTAVLDLKLTTKHKSMVQQYTCLGDMNGFVVWCLKGPFSPPAPQAKPRRVSLDIRSLSLDGPAPPQPLKPSNPPEAPPKVSRRRSKLDLPAGGVCDSSVCSGISAMDGVPFTLHPKFESRSSSTKVSVITLSDIRIKSVQDIENEYNYTFTVEELAAKRIRPSLSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry