AibGenesis™ Mouse Anti-myl10 Antibody (CBMOAB-88057FYA)


Cat: CBMOAB-88057FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88057FYA Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO88057FYA 100 µg
MO-AB-04541W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04541W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO88057FYA
SpecificityThis antibody binds to Zebrafish myl10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish myl10 Antibody is a mouse antibody against myl10. It can be used for myl10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:110679; myl10; zgc:11067
UniProt IDQ567X8
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MAPKKAKKKEAASSNVFSMFEQSQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRLNVGNDELDEMLKEASGPINFTIFLSMFGEKLKGTDPEETILNAFKIFDPEGTGILKGEEIKYHLMSQVDKFTEAEVNQMFTNFPLDVAGNLDYKNLCYVITHGEDKEQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry