AibGenesis™ Mouse Anti-ndnl2 Antibody (CBMOAB-88555FYA)


Cat: CBMOAB-88555FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88555FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO88555FYA 100 µg
MO-AB-16564R Monoclonal Cattle (Bos taurus) WB, ELISA MO16564R 100 µg
MO-AB-20122W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20122W 100 µg
MO-AB-26581W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26581W 100 µg
MO-AB-59844W Monoclonal Marmoset WB, ELISA MO59844W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO88555FYA
SpecificityThis antibody binds to Zebrafish ndnl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ndnl2 Antibody is a mouse antibody against ndnl2. It can be used for ndnl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMage; ndnl2; NP_001269018.
UniProt IDQ7T0K5
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MSQRKKATSASQNKTQRRSQLLLEEDEDANFSQITSSQAQRARENFTSDQIDHKVAEVVQFILIKDQKKIPIRRADIGKHVIKDYKHIYAEVMNRVCRTFEQVFGLKLVEIDLKQHIYILINKLEPIRGQTVSMHPGNPKMGLLFVILSVIFMKGGTIKENLVWNTLKKLRLDPGEKHDEFGDVKKVVTEEFVRQKYLEYGKIPHTEPVEYEFRWGLRAEKEVSKLKLLEFVGELFDQDPQNWTQQFREASTSGTSSQST.
For Research Use Only | Not For Clinical Use.
Online Inquiry