AibGenesis™ Mouse Anti-ndufa4 Antibody (CBMOAB-88603FYA)
Cat: CBMOAB-88603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-88603FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO88603FYA | 100 µg | ||
| MO-AB-05515H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05515C | 100 µg | ||
| MO-AB-16586R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16586R | 100 µg | ||
| MO-AB-20196W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20196W | 100 µg | ||
| MO-AB-27419H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27419C | 100 µg | ||
| MO-AB-27712R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27712R | 100 µg | ||
| MO-AB-37860W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37860W | 100 µg | ||
| MO-AB-59860W | Monoclonal | Marmoset | WB, ELISA | MO59860W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO88603FYA |
| Specificity | This antibody binds to Zebrafish ndufa4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish ndufa4 Antibody is a mouse antibody against ndufa4. It can be used for ndufa4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase subunit NDUFA4; ndufa |
| UniProt ID | Q6PBH5 |
| Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: MLATVMKQLKSHPALIPLFIFIGGGATMSMLYLGRLALKNPDCSWDRKNNPEPWNKLGPNDQYKLFSVNMDYSKLKKDRPDF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry