AibGenesis™ Mouse Anti-ngdn Antibody (CBMOAB-88957FYA)


Cat: CBMOAB-88957FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88957FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO88957FYA 100 µg
MO-AB-10746W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10746W 100 µg
MO-AB-16728R Monoclonal Cattle (Bos taurus) WB, ELISA MO16728R 100 µg
MO-AB-60041W Monoclonal Marmoset WB, ELISA MO60041W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO88957FYA
SpecificityThis antibody binds to Zebrafish ngdn.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ngdn Antibody is a mouse antibody against ngdn. It can be used for ngdn detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeuroguidin; EIF4E-binding protein; ngd
UniProt IDQ6PFJ1
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MAATAVGNDVIDRDLPTAVRLLNSLTEQIVSVTSHVRELIKKVREKAYQTSKGLSFLDLRYHLLLFYLQDITHLISLKTEGESLKDNSAIHRLVTIRTVLEKMRPLDQKLKYQIDKLVRTAVTGSLSENDPLHFRPNPQSLVSKLSESEDSDDDGVGGKTKEQKEPSGGRRYVPPRIAPMHYDGDLTEADRQKERVEKQKRAALRSSVIQELRQQYSDAPEEIRDRRDFQTDRQGREELNRKNYEESMMVRLSTTRDQKLRKRGMMGMTSQLSNITRFSDITALTGGEVQDIGNPKPKKKKIIKKGKKKVFRKRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry