AibGenesis™ Mouse Anti-nr2f5 Antibody (CBMOAB-89894FYA)


Cat: CBMOAB-89894FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89894FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO89894FYA 100 µg
Inquiry
MO-AB-05761H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05761C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO89894FYA
SpecificityThis antibody binds to Zebrafish nr2f5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPutative receptor that is required in photoreceptor cells precursors during eye development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish nr2f5 Antibody is a mouse antibody against nr2f5. It can be used for nr2f5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear receptor subfamily 2 group F member 5; Steroid receptor homolog SVP 46; nr2f5; svp4
UniProt IDQ06726
Protein RefseqThe length of the protein is 403 amino acids long.
The sequence is show below: MAMVVNQWQENISADPGSQLQMCSQEPGGTPGTPSGSTPGNDALSGDKIPNVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMSNSQSSPGQYLSNGSDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQSNNLMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRNQYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRDMLLSGSSYNWPYMPVQRDRPISIHYNENGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry