AibGenesis™ Mouse Anti-nt5c3a Antibody (CBMOAB-90161FYA)


Cat: CBMOAB-90161FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90161FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO90161FYA 100 µg
MO-AB-05793H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05793C 100 µg
MO-AB-16986R Monoclonal Cattle (Bos taurus) WB, ELISA MO16986R 100 µg
MO-AB-25508W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25508W 100 µg
MO-AB-60394W Monoclonal Marmoset WB, ELISA MO60394W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO90161FYA
SpecificityThis antibody binds to Zebrafish nt5c3a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. (From NCBI)
Product OverviewMouse Anti-Zebrafish nt5c3a Antibody is a mouse antibody against nt5c3a. It can be used for nt5c3a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesnt5c3a; nt5c3; 5'-Nucleotidase, Cytosolic IIIA
UniProt IDF8W3F7
Protein RefseqThe length of the protein is 368 amino acids long.
The sequence is show below: MDRNAVVKVGAMASATVCALFGGVVFAQYIFTKKQRAGKKTKIIEMGFRLWGVIGFEATPPLWQGYISACQTRNFFFSLTQRLEEEKMPEFEKNTVHIRDPERVEQIICGLIKGGASKLQIITDFDMTLSRFAVNGKRCPSCHNIIDNSKLVTDDCRKKLVHLKETYYPIEIDPHLTMEEKYPFMVEWYFKSHTLLVEQRLEKDKLPEAVRESDVSLKEGYEQFFDRLHQHSVPVFIFSAGLGDVLEEIIRQAGVYHPNVKVVSNFMDFDDNGVLKGFKGELIHVYNKHDGALRNTEYFKQLKDNGNIILLGDSLGDLTMADGVPNVENILKIGYLNDKVEELLEKYMDSYDIVLARDETLEVPNSIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry