Mouse Anti-Zebrafish nudt9 Antibody (CBMOAB-90307FYA)


Cat: CBMOAB-90307FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO90307FYA
SpecificityThis antibody binds to Zebrafish nudt9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish nudt9 Antibody is a mouse antibody against nudt9. It can be used for nudt9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesnudt9; Nudix Hydrolase 9
UniProt IDF1QL34
Protein RefseqThe length of the protein is 335 amino acids long.
The sequence is show below: MKSVSRKWVASVHVALSLIGLPFSAGTSGSCRRNGISFIPSVFASSSSSSSTLRMASPAHIKARCAVYPGSDTHRFPVPDDKVDWETDWPQYSPVNYTAPAVLKKPVWADLEIGAFCPQFNLLDGSVDRRSHEGQYRIQNGKPLNPHGRTGLEGRGLLGRWGPNHAADPIVTRWKIDSSGQRFLHADSKLPVLQFVSIKRLDCGEWAIPGGMVDPGERISQTLQREFSEEALNSLKASDSEREKIQKRISELFSSAGLQVYIGYVDDPRNTDNAWMETVAVNFHDESGDSVSELPLQAGDDAGQVSWTDIDSSLALYANHSQFLKTVAEERKAHW.
For Research Use Only | Not For Clinical Use.
Online Inquiry