Mouse Anti-Zebrafish ola1 Antibody (CBMOAB-90533FYA)


Cat: CBMOAB-90533FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO90533FYA
SpecificityThis antibody binds to Zebrafish ola1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22.
Product OverviewMouse Anti-Zebrafish ola1 Antibody is a mouse antibody against ola1. It can be used for ola1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesObg-like ATPase 1; ola
UniProt IDQ7ZU42
Protein RefseqThe length of the protein is 396 amino acids long.
The sequence is show below: MPPKKGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTRAFEDEDIIHVEGCVDPVRDIEIIHEELRMKDEEMIGPIIDKLEKTAVRGGDKKLKPEYDIMCKVKSWVVDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDAHDPGALVIPLSGGFESKYQDMSDEEKQKYCEENKTQSILTKIIKSGYSALQLEYFFTAGPDEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSENAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNQPKKK.
See other products for " OLA1 "
CBMOAB-53353FYAMouse Anti-Rhesus OLA1 Antibody (CBMOAB-53353FYA)
CBMOAB-02725CRMouse Anti-Yeast OLA1 Antibody (CBMOAB-02725CR)
MO-AB-21710WMouse Anti-Chimpanzee OLA1 Antibody (MO-AB-21710W)
MO-AB-09017YMouse Anti-Rabbit OLA1 Antibody (MO-AB-09017Y)
MO-AB-06668YMouse Anti-O. anatinus OLA1 Antibody (MO-AB-06668Y)
MO-AB-35212WMouse Anti-Ferret OLA1 Antibody (MO-AB-35212W)
MO-AB-32258WMouse Anti-Dog OLA1 Antibody (MO-AB-32258W)
MO-AB-05880HMouse Anti-Frog ola1 Antibody (MO-AB-05880H)
MO-AB-00923LMouse Anti-Elephant OLA1 Antibody (MO-AB-00923L)
MO-AB-08998WMouse Anti-Cat OLA1 Antibody (MO-AB-08998W)
For Research Use Only | Not For Clinical Use.
Online Inquiry