AibGenesis™ Mouse Anti-ormdl3 Antibody (CBMOAB-90972FYA)


Cat: CBMOAB-90972FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90972FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO90972FYA 100 µg
MO-AB-17352R Monoclonal Cattle (Bos taurus) WB, ELISA MO17352R 100 µg
MO-AB-21187W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21187W 100 µg
MO-AB-27677H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27677C 100 µg
MO-AB-60753W Monoclonal Marmoset WB, ELISA MO60753W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO90972FYA
SpecificityThis antibody binds to Zebrafish ormdl3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ormdl3 Antibody is a mouse antibody against ormdl3. It can be used for ormdl3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesORM1-like protein 3; ormdl
UniProt IDQ5XJR6
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISLLTVLIPKLPQFHGVRLFGINKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry