AibGenesis™ Mouse Anti-p2ry11 Antibody (CBMOAB-91196FYA)


Cat: CBMOAB-91196FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91196FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO91196FYA 100 µg
Inquiry
MO-AB-05939H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05939C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO91196FYA
SpecificityThis antibody binds to Zebrafish p2ry11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is coupled to the stimulation of the phosphoinositide and adenylyl cyclase pathways and behaves as a selective purinoceptor. Naturally occuring read-through transcripts, resulting from intergenic splicing between this gene and an immediately upstream gene (PPAN, encoding peter pan homolog), have been found. The PPAN-P2RY11 read-through mRNA is ubiquitously expressed and encodes a fusion protein that shares identity with each individual gene product. (From NCBI)
Product OverviewMouse Anti-Zebrafish p2ry11 Antibody is a mouse antibody against p2ry11. It can be used for p2ry11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesp2ry11; Purinergic Receptor P2Y11
UniProt IDX1WCK4
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: VEKSAQQTQARKTRAHRTPEMKNDSLCNESQFQIDLLPPMYGIEMTVALLGNIFALWLLGTRERKDWHTGVVFSCNLAISDVLYILTLPLLIIYYGKKKNWTFGDAVCKIERFLFTSNLYVSIFFIMCISVNRYIAIVYPFFTRSYVRPVHAKIASVLVWFIVIITSSPVFSFAGTEVVESDRVHNRTLCVSCKDKSRAKSHLKYTLFLMVVGCMIPFLVTFASYLGVIWTVLKNKNITTLEKRKVALMVALVCILYATSFVPYHFLQTYHVYLKSENLKECWLYNSYQVSKGLATLNMCLHPLLYMAVFDSIRTVCCGRSSDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry