AibGenesis™ Mouse Anti-pigk Antibody (CBMOAB-92577FYA)


Cat: CBMOAB-92577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92577FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO92577FYA 100 µg
Inquiry
MO-AB-05135W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05135W 100 µg
Inquiry
MO-AB-14385W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14385W 100 µg
Inquiry
MO-AB-17912R Monoclonal Cattle (Bos taurus) WB, ELISA MO17912R 100 µg
Inquiry
MO-AB-35413W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35413W 100 µg
Inquiry
MO-AB-43360W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43360W 100 µg
Inquiry
MO-AB-46030W Monoclonal Horse (Equus caballus) WB, ELISA MO46030W 100 µg
Inquiry
MO-AB-61514W Monoclonal Marmoset WB, ELISA MO61514W 100 µg
Inquiry
MO-DKB-01052W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, IHC, IHC-P 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset
CloneMO92577FYA
SpecificityThis antibody binds to Zebrafish pigk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. (From NCBI)
Product OverviewMouse Anti-Zebrafish pigk Antibody is a mouse antibody against pigk. It can be used for pigk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidylinositol glycan, class K; pig
UniProt IDQ6IQM5
Protein RefseqThe length of the protein is 389 amino acids long.
The sequence is show below: MDYSNLFTVYSCLLLFVSIPCAYSNYVETKAGQFFSSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNYRNPKPATVFSHKNMELNVYGDDVEVDYRGYEVTVENFLRVLTGRLPLSTPRSKRLLSDDRSNILIYLTGHGGNGFLKFQDSEEISNMELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDLAIGVHLMDKYTFYLLEFLEEVHPASQANMNDLFKVCPQSQCVSTPGHRTDLFQRDPGSVLITDFFGSVRKVEITKDTISLTCPVESPMQRSGSGDLQVETFTYVDQLPVAEIIHQKPKQKDWHPPDGFILGLWTLILLVFFQTYGIKHLKHIF.
For Research Use Only | Not For Clinical Use.
Online Inquiry