AibGenesis™ Mouse Anti-plgrkt Antibody (CBMOAB-92989FYA)


Cat: CBMOAB-92989FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92989FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO92989FYA 100 µg
MO-AB-17642W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17642W 100 µg
MO-AB-18082R Monoclonal Cattle (Bos taurus) WB, ELISA MO18082R 100 µg
MO-AB-27931H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27931C 100 µg
MO-AB-46073W Monoclonal Horse (Equus caballus) WB, ELISA MO46073W 100 µg
MO-AB-61752W Monoclonal Marmoset WB, ELISA MO61752W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO92989FYA
SpecificityThis antibody binds to Zebrafish plgrkt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish plgrkt Antibody is a mouse antibody against plgrkt. It can be used for plgrkt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:110385; plgrkt; zgc:11038
UniProt IDQ499A2
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MGFVLSKGMEQNFQKQQEFMLLNARLQLERQLAMQNQMRERQMAMQLAWSREFLKYFGSFFGLATLGLTVGAVKKRKPALLAPVIPLSFILVYQMDAAYGTMLQRMRAEAESIMVSECERLDVPHGMPTFESIEKSRRAKAHLTTLTEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry