AibGenesis™ Mouse Anti-polr2j Antibody (CBMOAB-93277FYA)


Cat: CBMOAB-93277FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93277FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO93277FYA 100 µg
MO-AB-05273W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05273W 100 µg
MO-AB-06406H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06406C 100 µg
MO-AB-18231R Monoclonal Cattle (Bos taurus) WB, ELISA MO18231R 100 µg
MO-AB-20726W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20726W 100 µg
MO-AB-27968H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27968C 100 µg
MO-AB-37974W Monoclonal Goat (Capra hircus) WB, ELISA MO37974W 100 µg
MO-AB-61949W Monoclonal Marmoset WB, ELISA MO61949W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO93277FYA
SpecificityThis antibody binds to Zebrafish polr2j.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish polr2j Antibody is a mouse antibody against polr2j. It can be used for polr2j detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPolr2j protein (Polymerase (RNA) II; DNA directed) polypeptide J; polr2
UniProt IDQ4VBU5
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: MNAPPAFESFLLFEGEKKITITKDTKVPNACLFTLNKEDHTLGNIIRSQLLKDPQVLFAGYKVPHPLEHKVVIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE.
For Research Use Only | Not For Clinical Use.
Online Inquiry