Mouse Anti-Zebrafish ppargc1a Antibody (CBMOAB-61296FYC)
Cat: CBMOAB-61296FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio) |
| Clone | MO61296FYC |
| Specificity | This antibody binds to Zebrafish ppargc1a. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This protein has nuclear receptor transcription coactivator activity and transcription coregulator activity, which can combine signaling receptor and transcription factor. It plays an important role in many biological processes, including brown fat cell differentiation, late distal convoluted tubule development, mitochondrion organization, positive regulation of DNA-binding transcription factor activity, positive regulation of transcription by RNA polymerase II, proximal straight tubule development and skeletal muscle tissue development. |
| Product Overview | Mouse Anti-Zebrafish ppargc1a Antibody is a mouse antibody against ppargc1a. It can be used for ppargc1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Peroxisome proliferator activated receptor gamma; ppargc1a |
| UniProt ID | D6QWW9 |
| Protein Refseq | The length of the protein is 56 amino acids long. The sequence is show below: ETLDSIPVDEDGLPSFEALADGDVTNASDQSCPSTPDGSPRTPEPEEPSLLKKLLL. |
See other products for " PPARGC1A "
| MO-AB-62014W | Mouse Anti-Marmoset PPARGC1A Antibody (MO-AB-62014W) |
| CBMOAB-93458FYA | Mouse Anti-Zebrafish ppargc1a Antibody (CBMOAB-93458FYA) |
| MO-AB-18306R | Mouse Anti-Cattle PPARGC1A Antibody (MO-AB-18306R) |
| MO-AB-38004W | Mouse Anti-Goat PPARGC1A Antibody (MO-AB-38004W) |
| MO-AB-17184Y | Mouse Anti-Sheep PPARGC1A Antibody (MO-AB-17184Y) |
| MO-AB-46128W | Mouse Anti-Horse PPARGC1A Antibody (MO-AB-46128W) |
| MO-AB-28489R | Mouse Anti-Pig PPARGC1A Antibody (MO-AB-28489R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry