AibGenesis™ Mouse Anti-prdm15 Antibody (CBMOAB-93799FYA)


Cat: CBMOAB-93799FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93799FYA Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO93799FYA 100 µg
MO-AB-05342W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05342W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO93799FYA
SpecificityThis antibody binds to Zebrafish prdm15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish prdm15 Antibody is a mouse antibody against prdm15. It can be used for prdm15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesprdm15
UniProt IDF1QWS4
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: QDSLNVRYFGKNGVRMAEPTPDEFIWCEDCGQYHDSECPELGPVVTVRDSFVLSRARSSLPDSLEIRLAEEGKEGVFVLRRLVRRTRFGPFEATRTSSLQTEGAFPLKIFQKDGSVVCFDTSNEDDCNWMMLVRPATDHKHQNLTAYQQDDDVYFNTSQDVLPGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry