AibGenesis™ Mouse Anti-psmg3 Antibody (CBMOAB-94340FYA)


Cat: CBMOAB-94340FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-94340FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO94340FYA 100 µg
MO-AB-06679H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06679C 100 µg
MO-AB-15767W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15767W 100 µg
MO-AB-18757R Monoclonal Cattle (Bos taurus) WB, ELISA MO18757R 100 µg
MO-AB-28166H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28166C 100 µg
MO-AB-62499W Monoclonal Marmoset WB, ELISA MO62499W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO94340FYA
SpecificityThis antibody binds to Zebrafish psmg3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish psmg3 Antibody is a mouse antibody against psmg3. It can be used for psmg3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProteasome (Prosome, macropain) assembly chaperone 3; Psmg3 protein; psmg
UniProt IDQ6DGH7
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MAPQPVIRSKQAEKTINGNQTQVVCTEFSNYIFIVLTQYGKIGTLVSITPDTRSGDISVPMYTSKVLLGKDEPLTHVYAKNVATFVSQESGNRPILLGLSLKDNSAETMKTVKDMIKSCQVW.
For Research Use Only | Not For Clinical Use.
Online Inquiry