Mouse Anti-Zebrafish rad51b Antibody (CBMOAB-95147FYA)


Cat: CBMOAB-95147FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO95147FYA
SpecificityThis antibody binds to Zebrafish rad51b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata.
Product OverviewMouse Anti-Zebrafish rad51b Antibody is a mouse antibody against rad51b. It can be used for rad51b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:56581; rad51b; rad51l1 zgc:5658
UniProt IDQ7ZTX4
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MGSKKLRRSGVSADLCERLKRHQLETCQDVLSVTQVELSRLAGLSYPAALNLQRLVSKACAPAVITALDLWKRKEELCFSTSLPALDRLLHGGLPRGALTEVTGPSGCGKTQLCMMLSVLATLPKSLGGLDSGVIYIDTESAFSAERLVEMAQSRFPEFFSVKERLLEMAARVHLFRELTCQDVLKRLERLEEDIIACRAGLVILDSVASVVRKEFDTSLPGNLTHRSNFLGQEAAVLKYLSQEFCIPVVLTNQITTHVGEKLHCPQWNQTDASFEEDSGFVTAALGNTWSHSVNTRLIVQYEDSERRQIVIAKSPVAPFAVLSYTIQKEGIRLEENMNPESFSNRGTDPGLQPIRVRTGFIFNLPQAAPSTC.
For Research Use Only | Not For Clinical Use.
Online Inquiry