AibGenesis™ Mouse Anti-rcan2 Antibody (CBMOAB-95577FYA)


Cat: CBMOAB-95577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95577FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO95577FYA 100 µg
MO-AB-05594W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05594W 100 µg
MO-AB-19143R Monoclonal Cattle (Bos taurus) WB, ELISA MO19143R 100 µg
MO-AB-21287W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21287W 100 µg
MO-AB-28390H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28390C 100 µg
MO-AB-63126W Monoclonal Marmoset WB, ELISA MO63126W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO95577FYA
SpecificityThis antibody binds to Zebrafish rcan2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the regulator of calcineurin (RCAN) protein family. These proteins play a role in many physiological processes by binding to the catalytic domain of calcineurin A, inhibiting calcineurin-mediated nuclear translocation of the transcription factor NFATC1. Expression of this gene in skin fibroblasts is upregulated by thyroid hormone, and the encoded protein may also play a role in endothelial cell function and angiogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish rcan2 Antibody is a mouse antibody against rcan2. It can be used for rcan2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrcan2; Regulator Of Calcineurin 2
UniProt IDE7F2L5
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MKGEHLFANMRSAPFFQRIYLLGGEELVVLQSTMGESSLGDSFQQITDFNDLPTSLFACNVDQSVFEDHEGKEMFEALFLAYDEGVTFQQFKSFRRVRINFSNPKAAASARIELHETPFRGKKLKLYFAQVQNPVSEGDNLHLAPPQPSKQFLISPPGSPPVGWQQIDEATPVINYDLLYAVAKLGPGEKFELHAGTESTPSVVVHVCDSDTDEEEEPKNNPKPKIIQTRRPDLPVSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry