AibGenesis™ Mouse Anti-rfk Antibody (CBMOAB-95748FYA)


Cat: CBMOAB-95748FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95748FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO95748FYA 100 µg
MO-AB-07064H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07064C 100 µg
MO-AB-19222R Monoclonal Cattle (Bos taurus) WB, ELISA MO19222R 100 µg
MO-AB-21771W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21771W 100 µg
MO-AB-28441H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28441C 100 µg
MO-AB-63215W Monoclonal Marmoset WB, ELISA MO63215W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO95748FYA
SpecificityThis antibody binds to Zebrafish rfk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rfk Antibody is a mouse antibody against rfk. It can be used for rfk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesrfk; si:dkey-162f21.5; Riboflavin Kinase
UniProt IDE7FE37
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MRSLPYFFRGPVVRGFGRGSKDLGIPTANFPESVVDSLPTDISTGIYYGWARLDNGDIHKMVMSIGWNPYYKNTKKSMEAHVIHTFKEDFYGHILSVAMAGYIRPERGFTSLDELITAIHNDIEEAKKKLDLPEHLKLKEDNFFKTSVSTTSNQILNGQHSLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry