AibGenesis™ Mouse Anti-ripply3 Antibody (CBMOAB-96045FYA)


Cat: CBMOAB-96045FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96045FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO96045FYA 100 µg
MO-AB-28511H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28511C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO96045FYA
SpecificityThis antibody binds to Zebrafish ripply3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ripply3 Antibody is a mouse antibody against ripply3. It can be used for ripply3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein ripply3; ripply
UniProt IDG1K2L8
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: MMLPVCVDADQALRCSVLWRPWSLSPTEARGHKTLAGGVRSARPSGGVFHHPVRLFLPRSRMQEYLSRLGSSVLASFPVQATLHFYNDEDSSSEEEEDEEHANTRCRLWRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry