AibGenesis™ Mouse Anti-Zebrafish rpe65c Antibody (CBMOAB-96367FYA)


Cat: CBMOAB-96367FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO96367FYA
SpecificityThis antibody binds to Zebrafish rpe65c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes both 11-cis retinol and 13-cis retinol, 2 stereoisomeric forms of retinoic acid from all-trans-retinyl ester. Acts as an alternative isomerohydrolase in retinal Mueller cells by catalyzing formation of 11-cis retinol, to meet the high demand for the chromophore by cones (PubMed:21676174). Capable of catalyzing the isomerization of lutein to meso-zeaxanthin an eye-specific carotenoid. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish rpe65c Antibody is a mouse antibody against rpe65c. It can be used for rpe65c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinal Mueller cells isomerohydrolase; rpe65
UniProt IDK9J6Q0
Protein RefseqThe length of the protein is 532 amino acids long.
The sequence is show below: MVSRLEHPAGGYKKVFESCEELAEPIPAHVSGEIPAWLSGSLLRMGPGLFEVGDEPFYHLFDGQALLHKFDLKDGRVTYHRRFIRTDAYVRAMTEKRVVITEFGTTAYPDPCKNIFSRFFTYFQGIEVTDNCLVNIYPIGEDFYACTETNFITKVDPDTLETVKKVDLCNYLSVNGLTAHPHIEADGTVYNIGNCFGKNMSLAYNIVKIPPLQEDKSDQFEKSKILVQFPSSERFKPSYVHSFGITENHFVFVETPVKINLLKFLTSWSIRGSNYMDCFESNDKMGTWFHLAAKNPGKYIDHKFRTSAFNIFHHINCFEDQGFIVVDLCTWKGHEFVYNYLYLANLRQNWEEVKKAALRAPQPEVRRYVLPLDIHREEQGKNLVSLPYTTATAVMCSDGTVWLEPEVLFSGPRQAFEFPQINYSKFNGKDYTFAYGLGLNHFVPDRICKLNVKSKETWIWQEPDAYPSEPLFVQSPDAEDEDDGVLLSIVVKPGVSQRPAFLLILKATDLTEIARAEVDVLIPLTLHGIYKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry