Mouse Anti-Zebrafish rpl22 Antibody (CBMOAB-96411FYA)
Cat: CBMOAB-96411FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio) |
Clone | MO96411FYA |
Specificity | This antibody binds to Zebrafish rpl22. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L22E family of ribosomal proteins. Its initiating methionine residue is post-translationally removed. The protein can bind specifically to Epstein-Barr virus-encoded RNAs (EBERs) 1 and 2. The mouse protein has been shown to be capable of binding to heparin. Transcript variants utilizing alternative polyA signals exist. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. It was previously thought that this gene mapped to 3q26 and that it was fused to the acute myeloid leukemia 1 (AML1) gene located at 21q22 in some therapy-related myelodysplastic syndrome patients with 3;21 translocations; however, these fusions actually involve a ribosomal protein L22 pseudogene located at 3q26, and this gene actually maps to 1p36.3-p36.2. |
Product Overview | Mouse Anti-Zebrafish rpl22 Antibody is a mouse antibody against rpl22. It can be used for rpl22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | rpl22; Ribosomal Protein L22 |
UniProt ID | F1QG80 |
Protein Refseq | The length of the protein is 141 amino acids long. The sequence is show below: MRFFSSSFLPKLSAMAPIKKQVTKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYFQINQDEEEEDED. |
See other products for " Rpl22 "
CBMOAB-29977FYA | Mouse Anti-D. melanogaster Rpl22 Antibody (CBMOAB-29977FYA) |
CBMOAB-89162FYB | Mouse Anti-Rice rpl22 Antibody (CBMOAB-89162FYB) |
CBMOAB-09298HCB | Mouse Anti-C. elegans RPL22 Antibody (CBMOAB-09298HCB) |
CBMOAB-40382FYC | Mouse Anti-Arabidopsis RPL22 Antibody (CBMOAB-40382FYC) |
MO-AB-39469W | Mouse Anti-Grape rpl22 Antibody (MO-AB-39469W) |
MO-AB-70307W | Mouse Anti-Silkworm RpL22 Antibody (MO-AB-70307W) |
MO-AB-30508H | Mouse Anti-Sugar beet rpl22 Antibody (MO-AB-30508H) |
MO-AB-03851Y | Mouse Anti-Chicken RPL22 Antibody (MO-AB-03851Y) |
MO-AB-00872H | Mouse Anti-Arabidopsis rpl22 Antibody (MO-AB-00872H) |
MO-AB-28602H | Mouse Anti-Rat Rpl22 Antibody (MO-AB-28602H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry