Mouse Anti-Zebrafish rpl6 Antibody (CBMOAB-96452FYA)


Cat: CBMOAB-96452FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO96452FYA
SpecificityThis antibody binds to Zebrafish rpl6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish rpl6 Antibody is a mouse antibody against rpl6. It can be used for rpl6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L6; rpl
UniProt IDQ6DRC6
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MAEGDKKKVARKHGSRNPELVRGIGRYSRSAMFARRAMYKRKTKAPVTKVEKKIKEKKVKQKSKNPTTAIKTVGGDKNGGTRVVKLRKMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITLGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKKKKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQLRGYLRSMFSLSNGVYPHKLVF.
See other products for " RPL6 "
MO-DKB-00720WRabbit Anti-RPL6 Antibody (MO-DKB-00720W)
MO-AB-38734WMouse Anti-Gorilla RPL6 Antibody (MO-AB-38734W)
CBMOAB-56776FYAMouse Anti-Rhesus RPL6 Antibody (CBMOAB-56776FYA)
MO-AB-12052WMouse Anti-Chimpanzee RPL6 Antibody (MO-AB-12052W)
MO-AB-06850YMouse Anti-O. anatinus RPL6 Antibody (MO-AB-06850Y)
MO-AB-19522RMouse Anti-Cattle RPL6 Antibody (MO-AB-19522R)
MO-AB-01285LMouse Anti-Elephant RPL6 Antibody (MO-AB-01285L)
MO-AB-70330WMouse Anti-Silkworm RpL6 Antibody (MO-AB-70330W)
MO-AB-33145WMouse Anti-Dog RPL6 Antibody (MO-AB-33145W)
MO-AB-03854YMouse Anti-Chicken RPL6 Antibody (MO-AB-03854Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry