Mouse Anti-Zebrafish rpl9 Antibody (CBMOAB-64057FYA)


Cat: CBMOAB-64057FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64057FYA
SpecificityThis antibody binds to Zebrafish rpl9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish rpl9 Antibody is a mouse antibody against rpl9. It can be used for rpl9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L9; rpl9
UniProt IDQ6DRM3
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MKTILSNQTVDIPDNVTVSLKGRTVTVKGPRGVLRREFNHINLELSLLGKKQKKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQESGSLVEIRNFLGEKYIRRVRMRQGVACAVSAAQKDELVLEGNDIELVSNSAALIQQATTVRKKDIRKFLDGIYVSEKGTVVEQQED.
See other products for " RPL9 "
MO-DKB-00793WRabbit Anti-RPL9 Antibody (MO-DKB-00793W)
CBMOAB-56781FYAMouse Anti-Rhesus RPL9 Antibody (CBMOAB-56781FYA)
CBMOAB-89187FYBMouse Anti-Rice RPL9 Antibody (CBMOAB-89187FYB)
MO-AB-07262HMouse Anti-Frog rpl9 Antibody (MO-AB-07262H)
MO-AB-19527RMouse Anti-Cattle RPL9 Antibody (MO-AB-19527R)
CBMOAB-40474FYCMouse Anti-Arabidopsis RPL9 Antibody (CBMOAB-40474FYC)
MO-AB-13081YMouse Anti-O. mykiss Rpl9 Antibody (MO-AB-13081Y)
CBMOAB-30045FYAMouse Anti-D. melanogaster Rpl9 Antibody (CBMOAB-30045FYA)
MO-DKB-01899WRabbit Anti-RPL9 Antibody (MO-DKB-01899W)
MO-AB-46372WMouse Anti-Horse RPL9 Antibody (MO-AB-46372W)
For Research Use Only | Not For Clinical Use.
Online Inquiry