Mouse Anti-Zebrafish rps2 Antibody (CBMOAB-96524FYA)


Cat: CBMOAB-96524FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO96524FYA
SpecificityThis antibody binds to Zebrafish rps2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-Zebrafish rps2 Antibody is a mouse antibody against rps2. It can be used for rps2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein S2; rps2; NP_998444.1;XP_005163928.
UniProt IDQ6NWC3
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MADDAGGRGGFRGGFGTGGRGRGRGRGRGRGRGRGARGGKSEDKEWVPVTKLGRLVKDMKIKSLEEIYLYSLPIKESEIIDFFLGSALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIIPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLAKTHTRVSVQRTQGALPQGTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry