Mouse Anti-Zebrafish sap18 Antibody (CBMOAB-97067FYA)


Cat: CBMOAB-97067FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO97067FYA
SpecificityThis antibody binds to Zebrafish sap18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2.
Product OverviewMouse Anti-Zebrafish sap18 Antibody is a mouse antibody against sap18. It can be used for sap18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSap18 protein; Sin3-associated polypeptide; sap1
UniProt IDQ6PC41
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MAVESRVTQEEIKKEPTKPVDREKTCPLLLRVFTTNNGRHHRMDEFARGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFGFAIVYPDPKRQIYRVKEIGNTVSGRKGADDSMTLQSQSFQIGDYLDIAITPPNRAPPLQGRMRPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry