AibGenesis™ Mouse Anti-sap30l Antibody (CBMOAB-97070FYA)


Cat: CBMOAB-97070FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97070FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO97070FYA 100 µg
MO-AB-05793W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05793W 100 µg
MO-AB-07411H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07411C 100 µg
MO-AB-20801W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20801W 100 µg
MO-AB-28822H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28822C 100 µg
MO-AB-63805W Monoclonal Marmoset WB, ELISA MO63805W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO97070FYA
SpecificityThis antibody binds to Zebrafish sap30l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish sap30l Antibody is a mouse antibody against sap30l. It can be used for sap30l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase complex subunit SAP30L; Sin3 corepressor complex subunit SAP30L; Sin3-associated protein p30-like; sap30
UniProt IDQ6NYV5
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MNGFSTEEDSHDGPPAPPFFGQSCCLIEDAERCGRPAGNASFSKRIQKSISQRKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGESPDHEVEVPEVDLFQLQVNTLRRYKRHYKIQTRPGLNKAQLAETVSRHFRNIPVNEKETLTYFIYMVKSSKSRLDQKSDSSKQVE.
For Research Use Only | Not For Clinical Use.
Online Inquiry