Mouse Anti-Zebrafish sdf2 Antibody (CBMOAB-97376FYA)


Cat: CBMOAB-97376FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO97376FYA
SpecificityThis antibody binds to Zebrafish sdf2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15.
Product OverviewMouse Anti-Zebrafish sdf2 Antibody is a mouse antibody against sdf2. It can be used for sdf2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesStromal cell-derived factor 2; sdf
UniProt IDQ7SXI7
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MDSFVFLRVQLPLTVLLSCVFTLTLCSEMNCVTCGSVVKLINVKHNVRLHSHDVRYGSGSGQQSVTGVTTVEDSNSYWSVRGTSDHSCHRGTPVRCGQNIRLTHVNTGRNLHSHYFTSPLSSNQEVSAFGENGEGDHLDEWTVLCVGSIWQRDESVRFQHTATEALLSVTGEQFGRPIHGQREVHGMMVSSSHSYWRTMEGIFIKPSEAGSRDFHSPLHSEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry