Mouse Anti-Zebrafish sdhc Antibody (CBMOAB-97387FYA)


Cat: CBMOAB-97387FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO97387FYA
SpecificityThis antibody binds to Zebrafish sdhc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Zebrafish sdhc Antibody is a mouse antibody against sdhc. It can be used for sdhc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessdhc; Succinate Dehydrogenase Complex Subunit C
UniProt IDB0S5Q2
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MALLLRTVARQGLYSSRSQFGVLYRHAVPMGTTSNEEMDKFWAKNTRLNRPMSPHMTIYKWSVPMAMSISHRGTGIALSSGISAFALAALVLPESYPYYLDLIHSLTFGPQFLAFSKFALAFPVVYHTYNGIRHLAWDAGKGFKIPEVYRSGYVVLGLTVLTSIGLAAM.
For Research Use Only | Not For Clinical Use.
Online Inquiry