AibGenesis™ Mouse Anti-selk Antibody (CBMOAB-97492FYA)


Cat: CBMOAB-97492FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97492FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes) WB, ELISA MO97492FYA 100 µg
Inquiry
MO-AB-26450W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26450W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes)
CloneMO97492FYA
SpecificityThis antibody binds to Zebrafish selk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for Ca flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration. Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins. Required for cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation. Required for palmitoylation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish selk Antibody is a mouse antibody against selk. It can be used for selk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSelenoprotein K; SelK; sel
UniProt IDQ66I79
Protein RefseqThe length of the protein is 94 amino acids long.
The sequence is show below: MVYVSNGQVLDSRSRSPWSLSFLTDFFWGAVEFIGLFFQTLVQPDLSKDGNNSASSRFSDGRGPPGFPGRRRMGRINHGAGPTPPPMGGGGUGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry