AibGenesis™ Mouse Anti-slmo2 Antibody (CBMOAB-06360FYB)


Cat: CBMOAB-06360FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06360FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO06360FYB 100 µg
MO-AB-06127W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06127W 100 µg
MO-AB-64833W Monoclonal Marmoset WB, ELISA MO64833W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta)
CloneMO06360FYB
SpecificityThis antibody binds to Zebrafish slmo2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish slmo2 Antibody is a mouse antibody against slmo2. It can be used for slmo2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC20orf45 homolog; H. sapiens; Chromosome 20 open reading frame 45; slmo2; C20orf45 c20orf4
UniProt IDQ7ZVG4
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MKIWTSEHIFNHPWETVTKAAMQKYPNPMNPSVFGVDVLDRNVDQQGRLHSKRLLSTEWGLPSIVRSLIGNTRTCTYIQEQSVVDPKEKTFELQSTNITFTNMVSVDERLIYRPHPEDPEKTMLTQEAIISVKGVSLSSYLEGLMASTISTNAGKGREAMEWVIRRLNTEIEELAMTARGTLRTPMAAAVADK.
For Research Use Only | Not For Clinical Use.
Online Inquiry