AibGenesis™ Mouse Anti-smim8 Antibody (CBMOAB-06528FYB)


Cat: CBMOAB-06528FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06528FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06528FYB 100 µg
MO-AB-20606R Monoclonal Cattle (Bos taurus) WB, ELISA MO20606R 100 µg
MO-AB-24592W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24592W 100 µg
MO-AB-29039H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29039C 100 µg
MO-AB-64928W Monoclonal Marmoset WB, ELISA MO64928W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO06528FYB
SpecificityThis antibody binds to Zebrafish smim8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSMIM8 (Small Integral Membrane Protein 8) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish smim8 Antibody is a mouse antibody against smim8. It can be used for smim8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall integral membrane protein 8; smim
UniProt IDQ502E5
Protein RefseqThe length of the protein is 104 amino acids long.
The sequence is show below: MSSGQSSSSSGKAGPQEPPSSAAEPAYRSPGLRGVRTTSLFRAVNPELFIRPNKPVMALGLLALSVCVGYLGYLHAIRDSDQQLYEAVDSDGETYMRRRTSRWD.
For Research Use Only | Not For Clinical Use.
Online Inquiry