AibGenesis™ Mouse Anti-Zebrafish smyd2a Antibody (CBMOAB-06604FYB)


Cat: CBMOAB-06604FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO06604FYB
SpecificityThis antibody binds to Zebrafish smyd2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProtein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish smyd2a Antibody is a mouse antibody against smyd2a. It can be used for smyd2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-lysine methyltransferase SMYD2-A; EC 2.1.1.-; Histone methyltransferase SMYD2-A; EC 2.1.1.43; SET and MYND domain-containing protein 2A; smyd2a; smyd
UniProt IDQ5BJI7
Protein RefseqThe length of the protein is 435 amino acids long.
The sequence is show below: MKKEGIEGTERFLSPGKGRGLKAIKHFKVGDLVFACPAYAYVLTVNERGGRCECCFTRKEGLSKCGKCKQAYYCNVECQRGDWPMHKLECSAMCAYGENWCPSETVRLVARIILKQKHQTERTPSERVLTLRELEAHLDKLDNEKNEMNDTDIAALHHFYSRHLDFPDNAALTELIAQVNCNGFTIEDEELSHLGSALFPDVALMNHSCSPNVIVTYKGTVAEVRAVQEINPEEEIFNSYIDLLYPTEDRIERLKDSYFFNCDCKECTSKSKDEAKMEIRQKLSIPPEEEEIKQMVIYARNVIEEFRRAKHYKTPSELLEICELSMEKMGAIFAETNVYMLHMMYQAMGVCLYMQDWDGAMKYGEKIIHPYSVHYPPYSLNVASMYLKLGRLYLGLEKRTQGVKALKKALAIMDIAHGKDHPYIDEIKKEMEEQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry