AibGenesis™ Mouse Anti-snrnp27 Antibody (CBMOAB-06700FYB)
Cat: CBMOAB-06700FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06700FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO06700FYB | 100 µg | ||
| MO-AB-06167W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06167W | 100 µg | ||
| MO-AB-10048Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10048Y | 100 µg | ||
| MO-AB-18285W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18285W | 100 µg | ||
| MO-AB-20662R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20662R | 100 µg | ||
| MO-AB-29070H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29070C | 100 µg | ||
| MO-AB-64999W | Monoclonal | Marmoset | WB, ELISA | MO64999W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO06700FYB |
| Specificity | This antibody binds to Zebrafish snrnp27. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a serine/arginine-rich (SR) protein. SR proteins play important roles in pre-mRNA splicing by facilitating the recognition and selection of splice sites. The encoded protein associates with the 25S U4/U6.U5 tri-snRNP, a major component of the U2-type spiceosome. The expression of this gene may be altered in cells infected with the human T-cell lymphotropic virus type 1 (HTLV-1) retrovirus. A pseudogene of this gene is located on the long arm of chromosome 5. Alternatively spliced transcript variants have been observed for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish snrnp27 Antibody is a mouse antibody against snrnp27. It can be used for snrnp27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; U4/U6.U5 snRNP 27 kDa protein; U4/U6.U5-27K; U4/U6.U5 tri-snRNP-associated protein 3; snrnp2 |
| UniProt ID | Q6DH74 |
| Protein Refseq | The length of the protein is 158 amino acids long. The sequence is show below: MGRSRSRTPPRRERRRSRSSSRDRERRRRERERSRSRDRDRRRSRSRSPHRRRSRSPRRHRSSSLSPLRQKDRRDDDRKDVKEKPAKVHQISAEDMQGKTEEEIEMMKLMGFGSFETSKGKKKDGSIKAFAVNVSQKRKYRQYMNRKGGFNRPLDFIA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry