Mouse Anti-Zebrafish sox14 Antibody (CBMOAB-06941FYB)


Cat: CBMOAB-06941FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO06941FYB
SpecificityThis antibody binds to Zebrafish sox14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.
Product OverviewMouse Anti-Zebrafish sox14 Antibody is a mouse antibody against sox14. It can be used for sox14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor Sox-14; sox1
UniProt IDQ32PP9
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MSKPADHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDHLKGLPVSATDSLLGSSEKARAFLPPTSAPYSFLDPSQFSSSAIQKMTEMPHTLATSTLPYASSLGYQNGAFGSLGCPSQHTHTHPSPTNPGYVVPCNCTAWSASSLQPPVAYILFPGMTKSGIDPYSSAHAAAM.
For Research Use Only | Not For Clinical Use.
Online Inquiry