AibGenesis™ Mouse Anti-spata45 Antibody (CBMOAB-07055FYB)


Cat: CBMOAB-07055FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07055FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO07055FYB 100 µg
MO-AB-20787R Monoclonal Cattle (Bos taurus) WB, ELISA MO20787R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO07055FYB
SpecificityThis antibody binds to Zebrafish spata45.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSPATA45 (Spermatogenesis Associated 45) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish spata45 Antibody is a mouse antibody against spata45. It can be used for spata45 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpermatogenesis-associated protein 45; spata4
UniProt IDQ5RGS7
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: MSKQERLYELNMHRETWCRVETTSKYWNLPERKHFRCHLQNTCDISALQTASPEQRSAWMSSGGQNTAHPERRHFEDSYRAHLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry