AibGenesis™ Mouse Anti-tmem179b Antibody (CBMOAB-09819FYB)


Cat: CBMOAB-09819FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09819FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO09819FYB 100 µg
MO-AB-12727W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12727W 100 µg
MO-AB-29557H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29557C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO09819FYB
SpecificityThis antibody binds to Zebrafish tmem179b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem179b Antibody is a mouse antibody against tmem179b. It can be used for tmem179b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 179B; tmem179b; OTTDARG00000031224 si:dkey-17e16.1
UniProt IDE7F498
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MMGLPWLLVLELVLYAGCFICGVIAAAWMTLTQGHFDGLCILYGSVHFNTSGQALTVEGSSSPSVCYFVSAIAVCMAIYCFSLILYWIYASCVEEDVRRGTVSLNTSLGVCGLLLFLLLVSGCILKIGRDSLCFSVLHNVPSLNSCEDAENKTWAHPYSGNQFYTGLYSTERSMWVSFFFWILITAVVVIQRRQSSSLKVWGDDEWSRAETEPFLHRPSRQR.
For Research Use Only | Not For Clinical Use.
Online Inquiry