AibGenesis™ Mouse Anti-tmem218 Antibody (CBMOAB-09890FYB)


Cat: CBMOAB-09890FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09890FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09890FYB 100 µg
MO-AB-21840R Monoclonal Cattle (Bos taurus) WB, ELISA MO21840R 100 µg
MO-AB-29577H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29577C 100 µg
MO-AB-66463W Monoclonal Marmoset WB, ELISA MO66463W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO09890FYB
SpecificityThis antibody binds to Zebrafish tmem218.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem218 Antibody is a mouse antibody against tmem218. It can be used for tmem218 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 218; tmem218; NP_956692.
UniProt IDQ7SZ56
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MADVVLGVGTGVFIITLIWILTLALTIILSRATGPTKLGIIPVVLLALIITLVLVFFPRAAEVPAPQRAAQIVDMFFIGRYVLLSLVSLVFLAALFMLLPLHFLEPIYAKPLRTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry