AibGenesis™ Mouse Anti-tmem45b Antibody (CBMOAB-09974FYB)


Cat: CBMOAB-09974FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09974FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO09974FYB 100 µg
MO-AB-08547H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08547C 100 µg
MO-AB-21883R Monoclonal Cattle (Bos taurus) WB, ELISA MO21883R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO09974FYB
SpecificityThis antibody binds to Zebrafish tmem45b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem45b Antibody is a mouse antibody against tmem45b. It can be used for tmem45b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 45B; tmem45
UniProt IDQ6P0S3
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MANFKGHALPGTFFLLFGLWWSIKCPFRQILRRKERQVGDRERQKLTALFNRIDLIEGSLKIFFAFVGIMAEQFVPDGPHAHLYQDGWVKLMNWQHSTMYLFYGISGIADVLSVSSHHVPVGLDRLFLSLALFVEGFLFYFHIHNREPLDQHIHSLLLFAVFGGSASTMMEVFKRENAVLELLRCTLAILQGTWFYQIGFVLYPLSGPEWDLTRHDNIMFITMCFCWHLAVALLIVGICYCGVFWTSKWCERRQRGDMEMGLRKSTSTDSSSQKALLQESDEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry